MDB: Melioidosis Database

Protein search results for - A4LT41

Names and origin

Entry	:	A4LT41 (unreviewed)
Entry name	:	A4LT41_BURPE
Protein names	:	50S ribosomal protein L23
Organism	:	Burkholderia pseudomallei 305
Organism ID	:	425067
Gene names	:	rplW
ORF names	:	BURPS305_2017

History

Date of creation	:	2007-05-15
Date of modification	:	2014-02-19
Date of sequence modification	:	2007-05-15

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	nucleotide binding; rRNA binding; ribosome; structural constituent of ribosome; translation
GO identifier	:	GO:0000166; GO:0019843; GO:0005840; GO:0003735; GO:0006412

Keywords

Ligand & Biological process

RNA-binding; Ribonucleoprotein; Ribosomal protein; rRNA-binding

General annotation

Sequence similarities

Belongs to Ribosomal protein L23P family

Protein sequence

Length

112 residues

>A4LT41|A4LT41_BURPE Burkholderia pseudomallei 305
MSEIRKNDHRLMQVLLAPVISEKATLVADKNEQVVFEVAPDATKQEVKAAVELLFKVEVD
SVNVLVQKGKQKRFGRSMGRRKDVKKAYVCLKPGQEINFEAEAK