MDB: Melioidosis Database

Protein search results for - A3P091

Names and origin

Entry	:	A3P091 (reviewed)
Entry name	:	RL36_BURP0
Protein names	:	50S ribosomal protein L36
Organism	:	Burkholderia pseudomallei 1106a
Organism ID	:	357348
Gene names	:	rpmJ
ORF names	:	BURPS1106A_3782

History

Date of creation	:	2007-09-11
Date of modification	:	2014-05-14
Date of sequence modification	:	2007-04-03

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	ribosome; structural constituent of ribosome; translation
GO identifier	:	GO:0005840; GO:0003735; GO:0006412

Keywords

Ligand & Biological process

Complete proteome; Ribonucleoprotein; Ribosomal protein

General annotation

Sequence similarities

Belongs to Ribosomal protein L36P family

Protein sequence

Length

42 residues

>A3P091|RL36_BURP0 Burkholderia pseudomallei 1106a
MKVMASVKRICRNCKIIKRKGVVRVICSSDPRHKQRQG