MDB: Melioidosis Database

Protein search results for - A3NZJ2

Names and origin

Entry	:	A3NZJ2 (reviewed)
Entry name	:	RL21_BURP0
Protein names	:	50S ribosomal protein L21
Organism	:	Burkholderia pseudomallei 1106a
Organism ID	:	357348
Gene names	:	rplU
ORF names	:	BURPS1106A_3526

History

Date of creation	:	2008-02-05
Date of modification	:	2014-05-14
Date of sequence modification	:	2007-04-03

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	rRNA binding; ribosome; structural constituent of ribosome; translation
GO identifier	:	GO:0019843; GO:0005840; GO:0003735; GO:0006412

Keywords

Ligand & Biological process

Complete proteome; RNA-binding; Ribonucleoprotein; Ribosomal protein; rRNA-binding

General annotation

Sequence similarities

Belongs to Ribosomal protein L21P family

Protein sequence

Length

111 residues

>A3NZJ2|RL21_BURP0 Burkholderia pseudomallei 1106a
MYAVIKTGGKQYKVAVGEKLKVEQIPADIDAEITLDQVLAVGEGESIQFGTPLVSGASVK
ATVVSHGRHAKVTIFKMRRRKHYQKHGGHRQNYTELRIDAINA