MDB: Melioidosis Database

Protein search results for - A3NYG8

Names and origin

Entry	:	A3NYG8 (unreviewed)
Entry name	:	A3NYG8_BURP0
Protein names	:	Rubredoxin
Organism	:	Burkholderia pseudomallei 1106a
Organism ID	:	357348
ORF names	:	BURPS1106A_3151

History

Date of creation	:	2007-04-03
Date of modification	:	2014-06-11
Date of sequence modification	:	2007-04-03

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	electron carrier activity; iron ion binding; oxidation-reduction process
GO identifier	:	GO:0009055; GO:0005506; GO:0055114

Keywords

Ligand & Biological process

Complete proteome; Electron transport; Iron; Metal-binding; Transport

General annotation

Sequence similarities

Belongs to Rubredoxin family

Protein sequence

Length

60 residues

>A3NYG8|A3NYG8_BURP0 Burkholderia pseudomallei 1106a
MEYKSWMCLICGWIYDEEAGLPEEGIAPGTRWEDVPINWTCPECGARKEDFEMVQI