MDB: Melioidosis Database

Protein search results for - A3NXW8

Names and origin

Entry	:	A3NXW8 (reviewed)
Entry name	:	IHFB_BURP0
Protein names	:	Integration host factor subunit beta (IHF-beta)
Organism	:	Burkholderia pseudomallei 1106a
Organism ID	:	357348
Gene names	:	ihfB
ORF names	:	himD

History

Date of creation	:	2009-04-14
Date of modification	:	2014-05-14
Date of sequence modification	:	2007-04-03

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	DNA binding; DNA recombination; chromosome; regulation of transcription, DNA-templated; regulation of translation; transcription, DNA-templated
GO identifier	:	GO:0003677; GO:0006310; GO:0005694; GO:0006355; GO:0006417; GO:0006351

Keywords

Ligand & Biological process

Complete proteome; DNA recombination; DNA-binding; Transcription; Transcription regulation; Translation regulation

General annotation

Sequence similarities

Belongs to Bacterial histone-like protein family

Protein sequence

Length

115 residues

>A3NXW8|IHFB_BURP0 Burkholderia pseudomallei 1106a
MTKSELVAQLASRFPQLVLKDADFAVKTMLDAMSDALSKGHRIEIRGFGSFGLNRRPARV
GRNPKSGEKVQVPEKHVPHFKPGKELRERVDGRAGEPLKNDEPEDAQ