MDB: Melioidosis Database

Protein search results for - A3NQZ9

Names and origin

Entry	:	A3NQZ9 (unreviewed)
Entry name	:	A3NQZ9_BURP0
Protein names	:	Nitrogen regulatory protein P-II
Organism	:	Burkholderia pseudomallei 1106a
Organism ID	:	357348
Gene names	:	glnB
ORF names	:	BURPS1106A_0487

History

Date of creation	:	2007-04-03
Date of modification	:	2014-05-14
Date of sequence modification	:	2007-04-03

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	enzyme regulator activity; regulation of nitrogen utilization; regulation of transcription, DNA-templated; transcription, DNA-templated
GO identifier	:	GO:0030234; GO:0006808; GO:0006355; GO:0006351

Keywords

Ligand & Biological process

Complete proteome; Transcription; Transcription regulation

General annotation

Sequence similarities

Belongs to P(II) protein family

Protein sequence

Length

120 residues

>A3NQZ9|A3NQZ9_BURP0 Burkholderia pseudomallei 1106a
MKLITAIIKPFKLDETREALSALGVSGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKMK
IEAAVSDDLVDQAVEAIERAARTGKIGDGKIFVTSIEQVIRIRTGETGADAL