MDB: Melioidosis Database

Protein search results for - A3NQB4

Names and origin

Entry	:	A3NQB4 (unreviewed)
Entry name	:	A3NQB4_BURP0
Protein names	:	High-potential iron-sulfur protein (HiPIP)
Organism	:	Burkholderia pseudomallei 1106a
Organism ID	:	357348
Gene names	:	hip
ORF names	:	BURPS1106A_0252

History

Date of creation	:	2007-04-03
Date of modification	:	2014-05-14
Date of sequence modification	:	2007-04-03

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	4 iron, 4 sulfur cluster binding; aerobic electron transport chain; electron carrier activity; metal ion binding
GO identifier	:	GO:0051539; GO:0019646; GO:0009055; GO:0046872

Keywords

Ligand & Biological process

4Fe-4S; Complete proteome; Electron transport; Iron; Iron-sulfur; Metal-binding; Transport

General annotation

Sequence similarities

Belongs to High-potential iron-sulfur protein (HiPIP) family

Protein sequence

Length

112 residues

>A3NQB4|A3NQB4_BURP0 Burkholderia pseudomallei 1106a
MKTSRRSFLITSVGAVSALALTREAFSADLPMLSETDPTAVALGYKADATKVDKAKFPKY
AAGEACAGCMLYQGKKGSASGPCGAFPGKQVAAKGWCNAFTKMA