MDB: Melioidosis Database

Protein search results for - A3NEI0

Names and origin

Entry	:	A3NEI0 (reviewed)
Entry name	:	RS10_BURP6
Protein names	:	30S ribosomal protein S10
Organism	:	Burkholderia pseudomallei 668
Organism ID	:	320373
Gene names	:	rpsJ
ORF names	:	BURPS668_3747

History

Date of creation	:	2008-01-15
Date of modification	:	2014-05-14
Date of sequence modification	:	2007-04-03

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	ribosome; structural constituent of ribosome; tRNA binding; translation
GO identifier	:	GO:0005840; GO:0003735; GO:0000049; GO:0006412

Keywords

Ligand & Biological process

Complete proteome; Ribonucleoprotein; Ribosomal protein

General annotation

Sequence similarities

Belongs to Ribosomal protein S10P family

Protein sequence

Length

111 residues

>A3NEI0|RS10_BURP6 Burkholderia pseudomallei 668
MQQQKIRIRLKAFDYRLIDQSAAEIVDTAKRTGAIVRGPVPLPTRIQRFDILRSPHVNKT
SRDQLEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKLQ