MDB: Melioidosis Database

Protein search results for - A3NEH4

Names and origin

Entry	:	A3NEH4 (reviewed)
Entry name	:	RL22_BURP6
Protein names	:	50S ribosomal protein L22
Organism	:	Burkholderia pseudomallei 668
Organism ID	:	320373
Gene names	:	rplV
ORF names	:	BURPS668_3741

History

Date of creation	:	2008-01-15
Date of modification	:	2014-05-14
Date of sequence modification	:	2007-04-03

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	large ribosomal subunit; rRNA binding; structural constituent of ribosome; translation
GO identifier	:	GO:0015934; GO:0019843; GO:0003735; GO:0006412

Keywords

Ligand & Biological process

Complete proteome; RNA-binding; Ribonucleoprotein; Ribosomal protein; rRNA-binding

General annotation

Sequence similarities

Belongs to Ribosomal protein L22P family

Protein sequence

Length

117 residues

>A3NEH4|RL22_BURP6 Burkholderia pseudomallei 668
MEVKAIHRGARISAQKTRLVADQIRGLPVDKALNVLTFSPKKAAGIVKKVVLSAIANAEH
NEGADIDELKIKSIYVDKAASLKRFTARAKGRGNRIEKQSCHITVTVGN