MDB: Melioidosis Database

Protein search results for - A3NCA9

Names and origin

Entry	:	A3NCA9 (reviewed)
Entry name	:	MINE_BURP6
Protein names	:	Cell division topological specificity factor
Organism	:	Burkholderia pseudomallei 668
Organism ID	:	320373
Gene names	:	minE
ORF names	:	BURPS668_2966

History

Date of creation	:	2008-01-15
Date of modification	:	2014-05-14
Date of sequence modification	:	2007-04-03

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	cell cycle; cell division; regulation of barrier septum assembly
GO identifier	:	GO:0007049; GO:0051301; GO:0032955

Keywords

Ligand & Biological process

Cell cycle; Cell division; Complete proteome

General annotation

Sequence similarities

Belongs to MinE family

Protein sequence

Length

92 residues

>A3NCA9|MINE_BURP6 Burkholderia pseudomallei 668
MSILSFLLGEKKKSAAVAKERLQLIIAHERVGGRPPADYLPALQKELVAVISKYVKISND
DIRVSLERQDDLEVLEVKIEIPQA