MDB: Melioidosis Database

Protein search results for - A3NA72

Names and origin

Entry	:	A3NA72 (unreviewed)
Entry name	:	A3NA72_BURP6
Protein names	:	Thioredoxin
Organism	:	Burkholderia pseudomallei 668
Organism ID	:	320373
Gene names	:	trx
ORF names	:	BURPS668_2208

History

Date of creation	:	2007-04-03
Date of modification	:	2014-06-11
Date of sequence modification	:	2007-04-03

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	cell redox homeostasis; glycerol ether metabolic process; protein disulfide oxidoreductase activity
GO identifier	:	GO:0045454; GO:0006662; GO:0015035

Keywords

Ligand & Biological process

Complete proteome

General annotation

Domains	:	Thioredoxin domain (1)
Sequence similarities	:	Belongs to Thioredoxin family

Protein sequence

Length

116 residues

>A3NA72|A3NA72_BURP6 Burkholderia pseudomallei 668
MSEQIKHISDASFEQDVVKSDKPVLLDFWAEWCGPCKMIAPILDEVAKDYGDKLQIAKIN
VDENQATPAKFGVRGIPTLILFKNGAVAAQKVGALSKSQLTAFLDSHL