MDB: Melioidosis Database

Protein search results for - A3N4M2

Names and origin

Entry	:	A3N4M2 (unreviewed)
Entry name	:	A3N4M2_BURP6
Protein names	:	High-potential iron-sulfur protein (HiPIP)
Organism	:	Burkholderia pseudomallei 668
Organism ID	:	320373
Gene names	:	hip
ORF names	:	BURPS668_0240

History

Date of creation	:	2007-04-03
Date of modification	:	2014-05-14
Date of sequence modification	:	2007-04-03

Protein attributes

Protein existence

Inferred from homology

Gene Ontology (GO)

GO term name	:	4 iron, 4 sulfur cluster binding; aerobic electron transport chain; electron carrier activity; metal ion binding
GO identifier	:	GO:0051539; GO:0019646; GO:0009055; GO:0046872

Keywords

Ligand & Biological process

4Fe-4S; Complete proteome; Electron transport; Iron; Iron-sulfur; Metal-binding; Transport

General annotation

Sequence similarities

Belongs to High-potential iron-sulfur protein (HiPIP) family

Protein sequence

Length

112 residues

>A3N4M2|A3N4M2_BURP6 Burkholderia pseudomallei 668
MKTSRRSFLITSVGAVSALALTREAFSADLPMLSETDPTAVALGYKADATKVDKAKFPKY
AAGEACAGCMLYQGKKGSASGPCGAFPGKQVAAKGWCNAFTKMA