HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P71346

Names and origin
Entry : P71346 (reviewed)
Entry name : RAIA_HAEIN
Protein names : Ribosome-associated inhibitor A
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : raiA
ORF names : HI_0257
History
Date of creation : 2000-12-01
Date of modification : 2013-11-13
Date of sequence modification : 2007-01-23
Protein attributes
Protein existence : Evidence at protein level
Gene Ontology (GO)
GO term name : primary metabolic process; regulation of translation; response to stress
GO identifier : GO:0044238; GO:0006417; GO:0006950
Keywords
Ligand & Biological process : 3D-structure; Complete proteome; Reference proteome; Stress response; Translation regulation
General annotation
Sequence similarities : Belongs to Hpf/RaiA ribosome-associated protein family, RaiA subfamily
Reference
PubMed ID : 7542800; 11551193
Protein sequence
Length : 115 residues
>P71346|RAIA_HAEIN Haemophilus influenzae Rd KW20
MTLNITSKQMDITPAIREHLEERLAKLGKWQTQLISPHFVLNKVPNGFSVEASIGTPLGN
LLASATSDDMYKAINEVEEKLERQLNKLQHKSESRRADERLKDSFEN