HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P71335

Names and origin
Entry : P71335 (reviewed)
Entry name : YBEY_HAEIN
Protein names : Endoribonuclease YbeY (EC 3.1.-.-)
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : ybeY
ORF names : HI_0004
EC number : 3.1.-.-
History
Date of creation : 1997-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1997-02-01
Protein attributes
Protein existence : Evidence at protein level
Gene Ontology (GO)
GO term name : cytoplasm; endoribonuclease activity; metalloendopeptidase activity; nucleic acid phosphodiester bond hydrolysis; rRNA processing; zinc ion binding
GO identifier : GO:0005737; GO:0004521; GO:0004222; GO:0090305; GO:0006364; GO:0008270
Keywords
Ligand & Biological process : 3D-structure; Complete proteome; Cytoplasm; Endonuclease; Hydrolase; Metal-binding; Nuclease; Reference proteome; Ribosome biogenesis; Zinc; rRNA processing
General annotation
Sequence similarities : Belongs to Endoribonuclease YbeY family
Subcellular location : Cytoplasm.
Reference
PubMed ID : 7542800; 15632286
Protein sequence
Length : 166 residues
>P71335|YBEY_HAEIN Haemophilus influenzae Rd KW20
MGSVLVDLQIATENIEGLPTEEQIVQWATGAVQPEGNEVEMTVRIVDEAESHELNLTYRG
KDRPTNVLSFPFECPDEVELPLLGDLVICRQVVEREASEQEKPLMAHWAHMVVHGSLHLL
GYDHIEDDEAEEMESLETQIMQGLGFDDPYLAEK