HIGDB: Haemophilus influenzae Genome Database

Protein search results for - P45344

Names and origin

Entry	:	P45344 (reviewed)
Entry name	:	ERPA_HAEIN
Protein names	:	Iron-sulfur cluster insertion protein ErpA
Organism	:	Haemophilus influenzae Rd KW20
Organism ID	:	71421
Gene names	:	erpA
ORF names	:	HI_1723

History

Date of creation	:	1995-11-01
Date of modification	:	2013-11-13
Date of sequence modification	:	1995-11-01

Protein attributes

Protein existence

Evidence at protein level

Gene Ontology (GO)

GO term name	:	iron ion binding; iron-sulfur cluster assembly; iron-sulfur cluster binding; structural molecule activity
GO identifier	:	GO:0005506; GO:0016226; GO:0051536; GO:0005198

Keywords

Ligand & Biological process

3D-structure; Complete proteome; Iron; Iron-sulfur; Metal-binding; Reference proteome

General annotation

Sequence similarities

Belongs to HesB/IscA family

Reference

PubMed ID

7542800; 10675023; 15014238;

Protein sequence

Length

122 residues

>P45344|ERPA_HAEIN Haemophilus influenzae Rd KW20
MIDDMAVPLTFTDAAANKVKSLISEEENTDLKLRVYITGGGCSGFQYGFTFDEKVNDGDL
TIEKSGVQLVIDPMSLQYLIGGTVDYTEGLEGSRFTVNNPNATSTCGCGSSFSI