HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P45202

Names and origin
Entry : P45202 (reviewed)
Entry name : YBAK_HAEIN
Protein names : Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK (EC 4.2.-.-)
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : ybaK
ORF names : HI_1434
EC number : 4.2.-.-
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 2001-02-21
Protein attributes
Protein existence : Evidence at protein level
Gene Ontology (GO)
GO term name : Ala-tRNA(Pro) hydrolase activity; cytoplasm; lyase activity; translation
GO identifier : GO:0043906; GO:0005737; GO:0016829; GO:0006412
Keywords
Ligand & Biological process : 3D-structure; Complete proteome; Cytoplasm; Lyase; Protein biosynthesis; Reference proteome
General annotation
Sequence similarities : Belongs to Prolyl-tRNA editing family, YbaK/EbsC subfamily
Subcellular location : Cytoplasm.
Reference
PubMed ID : 7542800; 15322138; 15886196; 16087664; 21768119; 10813833
Protein sequence
Length : 170 residues
>P45202|YBAK_HAEIN Haemophilus influenzae Rd KW20
MTPAIDLLKKQKIPFILHTYDHDPNNQHFGDEAAEKLGIDPNRSFKTLLVAENGDQKKLA
CFVLATANMLNLKKAAKSIGVKKVEMADKDAAQKSTGYLVGGISPLGQKKRVKTVINSTA
LEFETIYVSGGKRGLSVEIAPQDLAKVLGAEFTDIVDE