HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44853

Names and origin
Entry : P44853 (reviewed)
Entry name : SECB_HAEIN
Protein names : Protein-export protein SecB
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : secB
ORF names : HI_0743
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Evidence at protein level
Gene Ontology (GO)
GO term name : cytoplasm; protein folding; protein tetramerization; protein transport
GO identifier : GO:0005737; GO:0006457; GO:0051262; GO:0015031
Keywords
Ligand & Biological process : 3D-structure; Chaperone; Complete proteome; Cytoplasm; Protein transport; Reference proteome; Translocation; Transport
General annotation
Sequence similarities : Belongs to SecB family
Subcellular location : Cytoplasm.
Reference
PubMed ID : 7542800; 11101901
Protein sequence
Length : 181 residues
>P44853|SECB_HAEIN Haemophilus influenzae Rd KW20
MSEQKQDVAATEEQQPVLQIQRIYVKDVSFEAPNLPHIFQQEWKPKLGFDLSTETTQVGD
DLYEVVLNISVETTLEDSGDVAFICEVKQAGVFTISGLEDVQMAHCLTSQCPNMLFPYAR
ELVSNLVNRGTFPALNLSPVNFDALFVEYMNRQQAENAEEKSEEEQTKH