HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44814

Names and origin
Entry : P44814 (reviewed)
Entry name : DTD_HAEIN
Protein names : D-tyrosyl-tRNA(Tyr) deacylase (EC 3.1.-.-)
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : dtd
ORF names : HI_0670
EC number : 3.1.-.-
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Evidence at protein level
Gene Ontology (GO)
GO term name : D-amino acid catabolic process; cytoplasm; hydrolase activity, acting on ester bonds
GO identifier : GO:0019478; GO:0005737; GO:0016788
Keywords
Ligand & Biological process : 3D-structure; Complete proteome; Cytoplasm; Hydrolase; Reference proteome
General annotation
Sequence similarities : Belongs to DTD family
Subcellular location : Cytoplasm.
Reference
PubMed ID : 7542800; 12571243
Protein sequence
Length : 156 residues
>P44814|DTD_HAEIN Haemophilus influenzae Rd KW20
MIALIQRVSQAKVDVKGETIGKIGKGLLVLLGVEKEDNREKADKLAEKVLNYRIFSDEND
KMNLNVQQAQGELLIVSQFTLAADTQKGLRPSFSKGASPALANELYEYFIQKCAEKLPVS
TGQFAADMQVSLTNDGPVTFWLNV