HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44711

Names and origin
Entry : P44711 (reviewed)
Entry name : Y442_HAEIN
Protein names : Nucleoid-associated protein HI_0442
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
ORF names : HI_0442
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Evidence at protein level
Gene Ontology (GO)
GO term name : DNA binding; bacterial nucleoid; cytoplasm
GO identifier : GO:0003677; GO:0043590; GO:0005737
Keywords
Ligand & Biological process : 3D-structure; Complete proteome; Cytoplasm; DNA-binding; Reference proteome
General annotation
Sequence similarities : Belongs to YbaB/EbfC family
Subcellular location : Cytoplasm › nucleoid.
Reference
PubMed ID : 7542800; 10675023; 19594923; 12486730
Protein sequence
Length : 117 residues
>P44711|Y442_HAEIN Haemophilus influenzae Rd KW20
MFGKGGLGGLMKQAQQMQEKMQKMQEEIAQLEVTGESGAGLVKITINGAHNCRRIDIDPS
LMEDDKEMLEDLIAAAFNDAVRRAEELQKEKMASVTAGMPLPPGMKFPF