HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44654

Names and origin
Entry : P44654 (reviewed)
Entry name : NAPB_HAEIN
Protein names : Periplasmic nitrate reductase, electron transfer subunit (Diheme cytochrome c NapB)
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : napB
ORF names : HI_0347
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Evidence at protein level
Gene Ontology (GO)
GO term name : metal ion binding; oxidation-reduction process; periplasmic space
GO identifier : GO:0046872; GO:0055114; GO:0042597
Keywords
Ligand & Biological process : 3D-structure; Complete proteome; Direct protein sequencing; Electron transport; Heme; Iron; Metal-binding; Periplasm; Reference proteome; Signal; Transport
General annotation
Sequence similarities : Belongs to NapB family
Subcellular location : Periplasm.
Reference
PubMed ID : 7542800; 11389694; 11223519; 11939777
Protein sequence
Length : 162 residues
>P44654|NAPB_HAEIN Haemophilus influenzae Rd KW20
MINMTKQVSKILAGLFTALFAGSLMASDAPAVGKDLTQAAENIPPAFHNAPRQGELPALN
YVNQPPMVPHSVANYQVTKNVNQCLNCHSPENSRLSGATRISPTHFMDRDGKVGSSSSPR
RYFCLQCHVSQANVDPIVPNDFKPMKGYGN