HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44568

Names and origin
Entry : P44568 (reviewed)
Entry name : RIMM_HAEIN
Protein names : Ribosome maturation factor RimM
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : rimM
ORF names : HI_0203
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Evidence at protein level
Gene Ontology (GO)
GO term name : rRNA processing; ribosomal small subunit biogenesis; ribosome; ribosome binding
GO identifier : GO:0006364; GO:0042274; GO:0005840; GO:0043022
Keywords
Ligand & Biological process : 3D-structure; Chaperone; Complete proteome; Cytoplasm; Reference proteome; Ribosome biogenesis
General annotation
Domains : PRC barrel domain (1)
Sequence similarities : Belongs to RimM family
Subcellular location : Cytoplasm.
Reference
PubMed ID : 7542800
Protein sequence
Length : 190 residues
>P44568|RIMM_HAEIN Haemophilus influenzae Rd KW20
MKNMEQQHIEVVGKLGSTYGIRGWLRIYSSTEQAESIFDYQPWFLKIKGEWQSIELENWR
YHNHEIIVKLKGVDDREAAQILANVEIGVDLSVFPELEEGDYYWHDLIGCTVVNLEGYTM
GTVTEMMETGSNDVLVVKANTKDAFGKQERLIPFLYEQVVKRVDLTTKTIEVDWDAGF