HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P44492

Names and origin
Entry : P44492 (reviewed)
Entry name : TSAE_HAEIN
Protein names : tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaE)
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : tsaE
ORF names : yjeE
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Evidence at protein level
Gene Ontology (GO)
GO term name : ATP binding; cytoplasm; metal ion binding; threonylcarbamoyladenosine biosynthetic process
GO identifier : GO:0005524; GO:0005737; GO:0046872; GO:0070526
Keywords
Ligand & Biological process : 3D-structure; ATP-binding; Complete proteome; Cytoplasm; Magnesium; Metal-binding; Nucleotide-binding; Reference proteome; tRNA processing
General annotation
Sequence similarities : Belongs to TsaE family
Subcellular location : Cytoplasm.
Reference
PubMed ID : 7542800; 10675023; 12112691
Protein sequence
Length : 170 residues
>P44492|TSAE_HAEIN Haemophilus influenzae Rd KW20
MESLTQYIPDEFSMLRFGKKFAEILLKLHTEKAIMVYLNGDLGAGKTTLTRGMLQGIGHQ
GNVKSPTYTLVEEYNIAGKMIYHFDLYRLADPEELEFMGIRDYFNTDSICLIEWSEKGQG
ILPEADILVNIDYYDDARNIELIAQTNLGKNIISAFSN