HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P43769

Names and origin
Entry : P43769 (reviewed)
Entry name : TOLR_HAEIN
Protein names : Protein TolR
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : tolR
ORF names : HI_0384
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Evidence at protein level
Gene Ontology (GO)
GO term name : integral to membrane; plasma membrane; protein transport; transporter activity
GO identifier : GO:0016021; GO:0005886; GO:0015031; GO:0005215
Keywords
Ligand & Biological process : 3D-structure; Cell inner membrane; Cell membrane; Complete proteome; Membrane; Protein transport; Reference proteome; Transmembrane; Transmembrane helix; Transport
General annotation
Sequence similarities : Belongs to ExbD/TolR family
Subcellular location : Cell inner membrane; Single-pass type II membrane protein.
Reference
PubMed ID : 7542800; 8921895
Protein sequence
Length : 151 residues
>P43769|TOLR_HAEIN Haemophilus influenzae Rd KW20
MARRQRKAIKSEINIVPFLDVLLVLVLIFMATAPIISQSVQVELPDSVQSQEVSNEDKVP
VILEVAGIGKYAISIGGERQEGLTEEMVTQLSRQEFDKDNNTLFLVGGAKEVPYEEVIKA
LNLLHLAGIKSVGLMTNPI