HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P10324

Names and origin
Entry : P10324 (reviewed)
Entry name : PAL_HAEIN
Protein names : Outer membrane protein P6 (OMP P6) (15 kDa peptidoglycan-associated lipoprotein) (PC protein)
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : pal
ORF names : ompP6
History
Date of creation : 1989-07-01
Date of modification : 2013-11-13
Date of sequence modification : 1989-07-01
Protein attributes
Protein existence : Evidence at protein level
Gene Ontology (GO)
GO term name : cell outer membrane; integral to membrane
GO identifier : GO:0009279; GO:0016021
Keywords
Ligand & Biological process : 3D-structure; Cell outer membrane; Complete proteome; Direct protein sequencing; Lipoprotein; Membrane; Palmitate; Reference proteome; Signal
General annotation
Domains : OmpA-like domain (1)
Sequence similarities : Belongs to OmpA family, Pal subfamily
Subcellular location : Cell outer membrane; Lipid-anchor.
Reference
PubMed ID : 2828309; 3257200; 7542800; 16475801
Protein sequence
Length : 165 residues
>P10324|PAL_HAEIN Haemophilus influenzae Rd KW20
MNKFVKSLLVAGSVAALAACSSSNNDAAGNGAAQTFGGYSVADLQQRYNTVYFGFDKYDI
TGEYVQILDAHAAYLNATPAAKVLVEGNTDERGTPEYNIALGQRRADAVKGYLAGKGVDA
GKLGTVSYGEEKPAVLGHDEAAYSKNRRAVLAY