HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BMN7

Names and origin
Entry : T2BMN7 (unreviewed)
Entry name : T2BMN7_HAEIF
Protein names : Transcriptional repressor protein MetJ
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : metJ
ORF names : HifGL_001778
History
Date of creation : 2013-11-13
Date of modification : 2013-11-13
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Predicted
Protein sequence
Length : 113 residues
>T2BMN7|T2BMN7_HAEIF Haemophilus influenzae KR494
MANWDGKYISPYAEHGKKSEQVKKITVSIPIKVLEILTNERTRRQLKSLRHATNSELLCE
AFLHAFTGQPLPTDADLMKERNDEIPEDAKVLMRELGVDPENWEY