HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BMG2

Names and origin
Entry : T2BMG2 (unreviewed)
Entry name : T2BMG2_HAEIF
Protein names : Ferredoxin
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : fdx
ORF names : HifGL_001702
History
Date of creation : 2013-11-13
Date of modification : 2013-11-13
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Predicted
Protein sequence
Length : 121 residues
>T2BMG2|T2BMG2_HAEIF Haemophilus influenzae KR494
MPKVIFLPNEDFCPEGMVVDAATGDNLLEVAHNAGVEIHHACDGSCACTTCHVIVREGFD
SLNETSDQEEDMLDKAWGLEMDSRLSCQCVVGNEDLVVEIPKYNLNHANEAAH