HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BM95

Names and origin
Entry : T2BM95 (unreviewed)
Entry name : T2BM95_HAEIF
Protein names : Ribosomal silencing factor RsfS
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : rsfS
ORF names : HifGL_001532
History
Date of creation : 2013-11-13
Date of modification : 2013-12-11
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : Cytoplasm; Repressor; Translation regulation
General annotation
Sequence similarities : Belongs to Iojap/RsfS family
Subcellular location : Cytoplasm.
Protein sequence
Length : 110 residues
>T2BM95|T2BM95_HAEIF Haemophilus influenzae KR494
MALVEFLMETLEGLKGTDIVHFDVRGKSSITDNMIICTGTSSRQVSAMADNLITECKKAG
FETFGEEGKNTADWIVVDLGQAIVHIMQRDAREMYQLEKLWA