HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BM86

Names and origin
Entry : T2BM86 (unreviewed)
Entry name : T2BM86_HAEIF
Protein names : Citrate lyase acyl carrier protein (Citrate lyase gamma chain)
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : citD
ORF names : HifGL_001522
History
Date of creation : 2013-11-13
Date of modification : 2013-12-11
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : Cytoplasm; Lyase; Phosphoprotein
General annotation
Sequence similarities : Belongs to CitD family
Subcellular location : Cytoplasm.
Protein sequence
Length : 103 residues
>T2BM86|T2BM86_HAEIF Haemophilus influenzae KR494
MKITKVAVAGTLESSDVQVRVQPFDSLDIEINSSVAKQFGEQIEATVREVLAKLGITAAQ
VIVEDKGALDCVLQARVKVAAMRATDEMINWEAVL