HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BM72

Names and origin
Entry : T2BM72 (unreviewed)
Entry name : T2BM72_HAEIF
Protein names : L-fucose mutarotase (EC 5.1.3.n2) (Fucose 1-epimerase) (Type-2 mutarotase)
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : fucU
ORF names : HifGL_001605
EC number : 5.1.3.n2
History
Date of creation : 2013-11-13
Date of modification : 2013-12-11
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : Carbohydrate metabolism; Cytoplasm; Fucose metabolism; Isomerase
General annotation
Pathway : Carbohydrate metabolism; L-fucose metabolism.
Sequence similarities : Belongs to RbsD / FucU family, FucU mutarotase subfamily
Subcellular location : Cytoplasm.
Protein sequence
Length : 156 residues
>T2BM72|T2BM72_HAEIF Haemophilus influenzae KR494
MLKGIHPALSPELLKTLAEMGHGDEIVLADAHFPAHSLHKNVIRADGISIDILLEAITPL
FEFDAYVDAPLLMMKAVEGDSLDPNVETRYLNAIKSAVGFTPNLTCLERFDFYTRAKQAY
AVVVSGEIAKYGNIIIKKGVTPIL