HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BLM1

Names and origin
Entry : T2BLM1 (unreviewed)
Entry name : T2BLM1_HAEIF
Protein names : Iron-sulfur cluster insertion protein ErpA
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : erpA
ORF names : HifGL_001397
History
Date of creation : 2013-11-13
Date of modification : 2013-12-11
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : Iron; Iron-sulfur; Metal-binding
General annotation
Sequence similarities : Belongs to HesB/IscA family
Protein sequence
Length : 122 residues
>T2BLM1|T2BLM1_HAEIF Haemophilus influenzae KR494
MIDDIAVPLTFTDAAANKVKSLISEEENTNLKLRVYITGGGCSGFQYGFTFDEKVNDGDL
TIEKSGVQLVIDPMSLQYLIGGTVDYTEGLEGSRFTVNNPNATSTCGCGSSFSI