HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BLH2

Names and origin
Entry : T2BLH2 (unreviewed)
Entry name : T2BLH2_HAEIF
Protein names : Molybdopterin synthase sulfur carrier subunit
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : moaD
ORF names : HifGL_001339
History
Date of creation : 2013-11-13
Date of modification : 2013-11-13
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Predicted
Protein sequence
Length : 89 residues
>T2BLH2|T2BLH2_HAEIF Haemophilus influenzae KR494
MLNVLFFAQTRELIGIDVIQLEDDFATAEAVREHLAQKGDKWALALEKGKLLVAINQTLM
PLESAVKNGDEIAFFPPVTGG