HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BLD4

Names and origin
Entry : T2BLD4 (unreviewed)
Entry name : T2BLD4_HAEIF
Protein names : Mercuric ion scavenger protein
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : copZ2
ORF names : HifGL_001781
History
Date of creation : 2013-11-13
Date of modification : 2013-11-13
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Predicted
Protein sequence
Length : 76 residues
>T2BLD4|T2BLD4_HAEIF Haemophilus influenzae KR494
MKTITLNIKGIHCGCCVKSLTQVLTELDGVQSADVQLEGKVNITFDENRVNVAQLIEVIE
DAGFDATE