HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BL80

Names and origin
Entry : T2BL80 (unreviewed)
Entry name : T2BL80_HAEIF
Protein names : Toxin-antitoxin locus protein VapB1
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : vapB1
ORF names : HifGL_001751
History
Date of creation : 2013-11-13
Date of modification : 2013-11-13
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Predicted
Protein sequence
Length : 69 residues
>T2BL80|T2BL80_HAEIF Haemophilus influenzae KR494
MDFRFDVDTVEIFRKENGDVVLRPVSKKTDDFLALFEGFDETFIQALEARDDLPPQEREN
L