HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BL69

Names and origin
Entry : T2BL69 (unreviewed)
Entry name : T2BL69_HAEIF
Protein names : RNA-binding protein Hfq
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : hfq
ORF names : HifGL_001741
History
Date of creation : 2013-11-13
Date of modification : 2013-12-11
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : RNA-binding; Stress response
General annotation
Sequence similarities : Belongs to Hfq family
Protein sequence
Length : 99 residues
>T2BL69|T2BL69_HAEIF Haemophilus influenzae KR494
MAKGQSLQDPYLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAIS
TVVPARSVSHHNNNHHTAPTEAVENVETQAE