HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BL60

Names and origin
Entry : T2BL60 (unreviewed)
Entry name : T2BL60_HAEIF
Protein names : RnfH
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : rnfH
ORF names : HifGL_001725
History
Date of creation : 2013-11-13
Date of modification : 2013-12-11
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Inferred from homology
General annotation
Sequence similarities : Belongs to UPF0125 (RnfH) family
Protein sequence
Length : 110 residues
>T2BL60|T2BL60_HAEIF Haemophilus influenzae KR494
MNQINIEIAYAFPERYYLKSFQVDEGITVQTAITQSGILSQFPEIDLSTNKIGIFSRPIK
LTDVLKEGDRIEIYRPLLADPKEIRRKRAAEQAAAKNKEKGA