HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BL44

Names and origin
Entry : T2BL44 (unreviewed)
Entry name : T2BL44_HAEIF
Protein names : Molybdenum-pterin binding protein
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : mop
ORF names : HifGL_001115
History
Date of creation : 2013-11-13
Date of modification : 2013-11-13
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Predicted
Protein sequence
Length : 77 residues
>T2BL44|T2BL44_HAEIF Haemophilus influenzae KR494
MKISARNQLKGKVVSIENGSVNAIVHIDIGGGNVLSSTVSLAAVKELNLEVGKEAYAIIK
ATSVMVGVE