HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BL31

Names and origin
Entry : T2BL31 (unreviewed)
Entry name : T2BL31_HAEIF
Protein names : Iron-sulfur cluster assembly protein IscA
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : iscA
ORF names : HifGL_001706
History
Date of creation : 2013-11-13
Date of modification : 2013-11-13
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Predicted
Protein sequence
Length : 115 residues
>T2BL31|T2BL31_HAEIF Haemophilus influenzae KR494
MGITLTEKAAQRVKAFLDNRGKGIGLRLGVKTSGCSGLAYVLEFVDVLNSEDQVFEQHGV
NIIVDPKSLVYLNGIELDYVKEGLNEGFKYNNPNVKESCGCGESFHV