HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BL27

Names and origin
Entry : T2BL27 (unreviewed)
Entry name : T2BL27_HAEIF
Protein names : IscX
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : iscX
ORF names : HifGL_001701
History
Date of creation : 2013-11-13
Date of modification : 2013-11-13
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Predicted
Protein sequence
Length : 72 residues
>T2BL27|T2BL27_HAEIF Haemophilus influenzae KR494
MKWTDAQLIAEELYDRNPDLDPKTVRFTDLHKWICELEDFDDDPNKSNESILEAILLKWL
DEFE