HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BKZ6

Names and origin
Entry : T2BKZ6 (unreviewed)
Entry name : T2BKZ6_HAEIF
Protein names : 50S ribosomal protein L19
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : rplS
ORF names : HifGL_001657
History
Date of creation : 2013-11-13
Date of modification : 2013-12-11
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : Ribonucleoprotein; Ribosomal protein
General annotation
Sequence similarities : Belongs to Ribosomal protein L19P family
Protein sequence
Length : 124 residues
>T2BKZ6|T2BKZ6_HAEIF Haemophilus influenzae KR494
MSNIIKQLEQEQLKQNVPSFRPGDTLEVKVWVVEGSKRRLQAFEGVVIAIRNRGLHSAFT
LRKVSNGVGVERVFQTHSPAVDSIAVKRKGAVRKAKLYYLRARSGKSARIKERLGA