HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BKU4

Names and origin
Entry : T2BKU4 (unreviewed)
Entry name : T2BKU4_HAEIF
Protein names : Flavodoxin NrdI
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
ORF names : HifGL_001082
History
Date of creation : 2013-11-13
Date of modification : 2013-11-13
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Predicted
Protein sequence
Length : 90 residues
>T2BKU4|T2BKU4_HAEIF Haemophilus influenzae KR494
MKIHLIRHNTTLEFNNETSLLDHLEKNNIHHEYQCRNGYCGSCRVKIKKGKVSYKEMPLA
FLQPDEILLCCCQVESDIELDL