HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BKT5

Names and origin
Entry : T2BKT5 (unreviewed)
Entry name : T2BKT5_HAEIF
Protein names : Putative homeodomain-like protein
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
ORF names : HifGL_001072
History
Date of creation : 2013-11-13
Date of modification : 2013-11-13
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Predicted
Keywords
Ligand & Biological process : DNA-binding; Homeobox
Protein sequence
Length : 45 residues
>T2BKT5|T2BKT5_HAEIF Haemophilus influenzae KR494
MTALLQGIFMPIRPNLAEKNTIIQRHKLKLDKSYFTQPAVI