HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BKS6

Names and origin
Entry : T2BKS6 (unreviewed)
Entry name : T2BKS6_HAEIF
Protein names : Glutaredoxin-1
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : grxA
ORF names : HifGL_001062
History
Date of creation : 2013-11-13
Date of modification : 2013-11-13
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Predicted
Protein sequence
Length : 95 residues
>T2BKS6|T2BKS6_HAEIF Haemophilus influenzae KR494
MFVVIFGRPGCPYCVRAKNLAEKLKGEVADFGYRYVDIHAEGITKEDLSKSVGKPVETVP
QIFIDEKPIGGCTDFEALMKEQFGIVA