HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BKP9

Names and origin
Entry : T2BKP9 (unreviewed)
Entry name : T2BKP9_HAEIF
Protein names : Addiction module antitoxin/ rele toxin-like protein
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : relE2
ORF names : HifGL_000957
History
Date of creation : 2013-11-13
Date of modification : 2013-11-13
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Predicted
Protein sequence
Length : 59 residues
>T2BKP9|T2BKP9_HAEIF Haemophilus influenzae KR494
MNSLPLPEKYKDHALTGNWKGWRDCHIKNDLVLIYKIVGDEIRLARLNTHSEIFG