HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BKE7

Names and origin
Entry : T2BKE7 (unreviewed)
Entry name : T2BKE7_HAEIF
Protein names : Integration host factor subunit beta (IHF-beta)
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : ihfB
ORF names : himD
History
Date of creation : 2013-11-13
Date of modification : 2013-12-11
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : DNA recombination; DNA-binding; Transcription; Transcription regulation; Translation regulation
General annotation
Sequence similarities : Belongs to Bacterial histone-like protein family
Protein sequence
Length : 102 residues
>T2BKE7|T2BKE7_HAEIF Haemophilus influenzae KR494
MTKSELIEKLLAKQPTLPAKEIENMVKDILEFISQSLENGDRVEIRGFGSFSLHHRQPRL
GRNPKTGDSVNLSAKSVPYFKAGKELKARVDVQA