HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BKD9

Names and origin
Entry : T2BKD9 (unreviewed)
Entry name : T2BKD9_HAEIF
Protein names : Glutaredoxin
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : grxD
ORF names : HifGL_001460
History
Date of creation : 2013-11-13
Date of modification : 2013-11-13
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Predicted
Protein sequence
Length : 115 residues
>T2BKD9|T2BKD9_HAEIF Haemophilus influenzae KR494
METLDKIKKQISENPILIYMKGSPKLPSCGFSARASEALMHCKVPFGYVDILQHPDIRAE
LPTYANWPTFPQLWVEGELIGGCDIILEMYQAGELQTLLAEVAAKHA