HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BKA5

Names and origin
Entry : T2BKA5 (unreviewed)
Entry name : T2BKA5_HAEIF
Protein names : Putative YdcH
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : ydcH
ORF names : HifGL_000886
History
Date of creation : 2013-11-13
Date of modification : 2013-11-13
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Predicted
Protein sequence
Length : 80 residues
>T2BKA5|T2BKA5_HAEIF Haemophilus influenzae KR494
MFPEYRDLITKLKSNDAYFDRLFEKHNELDHEIKNMQENIQLATHMEIEALKKEKLRIKD
ELYEYLKKKSQE