HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BK97

Names and origin
Entry : T2BK97 (unreviewed)
Entry name : T2BK97_HAEIF
Protein names : Branched-chain amino acid permease
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
ORF names : HifGL_001412
History
Date of creation : 2013-11-13
Date of modification : 2013-11-13
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Predicted
Protein sequence
Length : 117 residues
>T2BK97|T2BK97_HAEIF Haemophilus influenzae KR494
MTLTEQIITIGICIVAVQFTRLLPFFVFPVNRPIPQYIRYLGKVLPPAMFGMLVVYCYKN
IDILTGYHGIPDLLAGIVVLGLHFWKKNMFLSIAVGTLFYMALVQLIFI