HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BK84

Names and origin
Entry : T2BK84 (unreviewed)
Entry name : T2BK84_HAEIF
Protein names : Phosphocarrier protein HPr
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : ptsH
ORF names : HifGL_001390
History
Date of creation : 2013-11-13
Date of modification : 2013-11-13
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Predicted
Protein sequence
Length : 93 residues
>T2BK84|T2BK84_HAEIF Haemophilus influenzae KR494
MYSKDVEIIAPNGLHTRPAAQFVKEAKAFSSEITVTSGGKSASAKSLFKLQTLALTQGTI
LTISADGEDEQQAVEHLVALIPTLE