HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BK72

Names and origin
Entry : T2BK72 (unreviewed)
Entry name : T2BK72_HAEIF
Protein names : Thioredoxin
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : trxA
ORF names : HifGL_000858
History
Date of creation : 2013-11-13
Date of modification : 2013-11-13
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Predicted
Protein sequence
Length : 115 residues
>T2BK72|T2BK72_HAEIF Haemophilus influenzae KR494
MSEVLHINDADFESVVVNSNIPVLLDFWAPWCGPCKMIAPVLDKLAPEFAGKVKIVKMNV
DDNQATPAQFGVRSIPTLLLIKNGQVVATQVGALPKTQLANFINQHI