HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BK65

Names and origin
Entry : T2BK65 (unreviewed)
Entry name : T2BK65_HAEIF
Protein names : Terminase subunit endonuclease
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
ORF names : HifGL_001374
History
Date of creation : 2013-11-13
Date of modification : 2013-11-13
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Predicted
Keywords
Ligand & Biological process : Endonuclease; Hydrolase; Nuclease
Protein sequence
Length : 45 residues
>T2BK65|T2BK65_HAEIF Haemophilus influenzae KR494
MVEKHPEQALAYLERALGLDQKIGVKGDIKKLKKQLSTTEY